PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g017480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 53aa    MW: 5850.72 Da    PI: 9.394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g017480.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.2e-121452139
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                     rg W++eEde+l+++ + +G g+W+++++  g+ R++k+
  Medtr8g017480.1 14 RGLWSPEEDEKLIKYSTTYGHGCWSSVPKLAGLQRCGKS 52
                     789*****************************99**985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-17652IPR009057Homeodomain-like
PROSITE profilePS5129416.011952IPR017930Myb domain
SuperFamilySSF466891.72E-10951IPR009057Homeodomain-like
PfamPF002499.6E-101452IPR001005SANT/Myb domain
CDDcd001673.04E-61752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLIKYST TYGHGCWSSV PKLAGLQRCG KS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004510395.13e-32PREDICTED: transcription repressor MYB6
RefseqXP_013444368.13e-32myb transcription factor
RefseqXP_013444371.15e-32myb-like DNA-binding domain protein
SwissprotQ9SPG32e-26MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A0S3SZS02e-32A0A0S3SZS0_PHAAN; Uncharacterized protein
TrEMBLA0A0L9TIJ62e-32A0A0L9TIJ6_PHAAN; Uncharacterized protein
STRINGGLYMA08G20440.23e-31(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1750046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-30myb domain protein 26